PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P20260_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 1102aa    MW: 123783 Da    PI: 7.36
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P20260_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.79e-13171610981373
                    GRAS    1 lvelLlecAeavss.gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84  
                              l++lLl+cA+ v+s g+l  a+a+L+++  la+pdgd+mqR+a++f+eALa+r  rs+++l++al + +  +   +e++ a++ f
  GSMUA_Achr11P20260_001  716 LIHLLLDCANRVASgGSLDPANAALEQIALLAAPDGDAMQRIASHFAEALARRAIRSWPGLCHALDSARVLP--LAEAAVARRHF 798 
                              689*********9978999**********************************************6666653..99999****** PP

                    GRAS   85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfA 169 
                               +++P+l++s++++NqaI+ea+ege+ vH++D+++s ++QW++LlqaL+sR+egpp+l+iTg+++    +ke l+ t+ rL++ A
  GSMUA_Achr11P20260_001  799 LDLCPFLRLSFVVTNQAIMEAMEGERVVHVVDLNASDPAQWIPLLQALSSRSEGPPHLKITGIHE----HKEVLHYTAIRLSEAA 879 
                              *****************************************************************....9*************** PP

                    GRAS  170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll...............desvsles.erdevLklvkslsPkv 238 
                              e+l+vpf+f + +++rl++l++e+Lrvk+gEala+++vlqlh+ll               +es++ +  +++++L  +++lsPk+
  GSMUA_Achr11P20260_001  880 ERLDVPFQFIP-LVSRLDNLDIERLRVKTGEALAISSVLQLHSLLatedkdhlanthstsAESAARPPtRIQSFLASLWGLSPKI 963 
                              ***********.599****************************************99988444444444889************* PP

                    GRAS  239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323 
                              vvv+eqea+hn++++ er++eal yy+a+fd l+ ++pr+s er  vE++l+g+ei+n++aceg er+erhe+le+W++r+++aG
  GSMUA_Achr11P20260_001  964 VVVTEQEANHNGKTLKERLVEALFYYAAVFDGLDLTVPRQSVERLRVEKMLFGEEIRNIIACEGLERKERHEKLERWSQRMSMAG 1048
                              ************************************************************************************* PP

                    GRAS  324 FkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                              F+ +pls++   qa++ll+ ++++gy+v+ee+g+++++W+drpL+svSaW
  GSMUA_Achr11P20260_001 1049 FRLLPLSYYGLLQARRLLQSFGWQGYKVKEENGCFMMCWQDRPLFSVSAW 1098
                              ************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF529802.33E-28397539IPR011335Restriction endonuclease type II-like
Gene3DG3DSA:3.40.50.101304.6E-26397543IPR020819DNA repair nuclease, XPF-type/Helicase
SMARTSM008918.4E-23400497IPR006166ERCC4 domain
PfamPF027321.0E-18404532IPR006166ERCC4 domain
PROSITE profilePS5098557.5266901079IPR005202Transcription factor GRAS
PfamPF035143.1E-1287161098IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006259Biological ProcessDNA metabolic process
GO:0003677Molecular FunctionDNA binding
GO:0004518Molecular Functionnuclease activity
Sequence ? help Back to Top
Protein Sequence    Length: 1102 aa     Download sequence    Send to blast
MENLRPVRCS ENEEIGLYLW RKRQEMVESN GLSENLDQTL SKAYRSICDA KTPIKTLKDL  60
SQIKGVGKWI LRLMQGFFQE SVADVPSTTN EAHAKGKKSK EPKRYVPKKN SVAYALLITL  120
YRAMTNGSSY MKKQELIDAA EASGLSRTSI ASDKSKQPGQ FGISSRDWYT GWNCMKSLIS  180
KGLVVKSSCP AKYMLTQEGQ EAARECLLRS GSIDLEPAKA TCRSHSALDG QSASPVDLTL  240
QSASVSCQTE MIDIPTEYVD RYKQADFLDS DHDSANLEKC SYSTAETCMP IVLGIFTLNE  300
MRLIYCRLHS LNVSFIPYSY PNLMVVVPDS IANIPVGDAR CRNSVYADAA QSSFNLRACT  360
SFDSPMHKPS ANDATKGNDN AIAMPPYRSG EKFEDIYDVI LILDDRENFG SRSRKIVDNI  420
HTQFNILVEF RRLPVGDGIW IARHRGCNTE YVLDFIVERK RVDDLCRSIR DNRYKDQKLR  480
LQRCGLQKLI YLVEGDQNCL EAAESIKTAC FTTEILEGFD VQRTSGFADT VRRYGYLTKS  540
IIQYYTMHFI DKAMCSRVCP SYDEFVKKCQ DLEKMTISDV FALQLMQVPQ VTEEIALAVV  600
DLYPTLLSLA QAYSHIEGDL RAQEELLKNR SKIISASASR NIFKLIWGHL ARFICLPERA  660
KRAMMPLLAG VVVQDDGSSS SVTSSPLETL SLSPPSLSPH SPWVRELKSD ERGLCLIHLL  720
LDCANRVASG GSLDPANAAL EQIALLAAPD GDAMQRIASH FAEALARRAI RSWPGLCHAL  780
DSARVLPLAE AAVARRHFLD LCPFLRLSFV VTNQAIMEAM EGERVVHVVD LNASDPAQWI  840
PLLQALSSRS EGPPHLKITG IHEHKEVLHY TAIRLSEAAE RLDVPFQFIP LVSRLDNLDI  900
ERLRVKTGEA LAISSVLQLH SLLATEDKDH LANTHSTSAE SAARPPTRIQ SFLASLWGLS  960
PKIVVVTEQE ANHNGKTLKE RLVEALFYYA AVFDGLDLTV PRQSVERLRV EKMLFGEEIR  1020
NIIACEGLER KERHEKLERW SQRMSMAGFR LLPLSYYGLL QARRLLQSFG WQGYKVKEEN  1080
GCFMMCWQDR PLFSVSAWSC NQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4771610984374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384384.10.0PREDICTED: crossover junction endonuclease MUS81
SwissprotQ8GT060.0MUS81_ORYSJ; Crossover junction endonuclease MUS81
TrEMBLM0RTV60.0M0RTV6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P20260_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-156scarecrow-like 3